DPCstruct | MC26127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 19.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3LUV0 | 2-125 | STTPNQPEKVQSDAKPAYPSPDQPNKEEEEEGECGLCLYMKAGGCKDAFIDWDNCAKEAEDKNEDFVEKCSQVTARLMQCMNAHSNY… |
| A0A7C9CK73 | 30-117 | KGVNGGDERKQEGEECQFCVLMKGGGCKDEFIAWQRCIQEAEETKEDAVEKCFDVIVGLSKCVNAHSAYYEGVLRAEKALMEELQHES |
| D7KBG4 | 32-158 | None |
| A0A103YAJ3 | 1-158 | None |
| A0A5J5ARF6 | 27-157 | None |
| A0A7R9TCB6 | 23-137 | None |
| A4RYW7 | 1-128 | None |
| A0A1J3H8M4 | 11-132 | None |
| A0A6J0NTN2 | 17-140 | None |
| A0A4S8JE78 | 19-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.