DPCstruct | MC26125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 179 ± 23 aa |
| Standard deviation of domain lengths | 23.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7L2W9 | 274-420 | ALLSDLASLVWSAYQVLLVPSLRVSVPLMNSLIVEFIHVHESENKDLNGLDWNSIERTFMDEANAGGLLLGGQSLKFKTYDVSFKDC… |
| A0A2K3LK85 | 2-200 | RDLKNELQSFEGEEYDESHKAKAIETLKRMESWNLFSDTHEEFQNYTVARDSFLSHLGATLWGSMRHIISPSVSDGAFHYYEKISFQ… |
| A0A0E0GPU2 | 98-295 | None |
| A0A151T2N0 | 169-364 | None |
| A0A4S4DDZ8 | 107-285 | None |
| A0A453MAK0 | 176-367 | None |
| A0A453MAV9 | 18-219 | None |
| L1I7V0 | 336-489 | None |
| A0A7J7PAS1 | 314-454 | None |
| A0A7J7LVP0 | 47-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.