DPCstruct | MC26123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 13 aa |
| Standard deviation of domain lengths | 13.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8KZN1 | 8-79 | YSVRMRASMNGSHEDGGKHISGGERLIPFHEMKHTVNALLEKGLSHSRGKPDFMQIQFEEVHESIKTIQPLP |
| A0A2X2MF29 | 1-93 | MYSIKMRSSNQDIHISGAETICEFDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIMEPIKQIKALQIIEDDKANLQHLTQKCGVTE… |
| A0A1C5WTG0 | 4-71 | None |
| T2RGI3 | 1-71 | None |
| A0A1J5NYP4 | 6-67 | None |
| A0A5C2NTB2 | 1-61 | None |
| A0A4Y7X651 | 5-84 | None |
| K0B241 | 6-87 | None |
| A0A5C8X928 | 1-70 | None |
| A0A3D3CNB3 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.