DPCstruct | MC26122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.91 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0039- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0L8B1 | 3-57 | DSQRLIEDAAALSEAGAFGVLMEMVPASTAAAVDAAVSIPTIGIGAGSTTTGQVL |
| A0A2X2LWW8 | 10-78 | KVQRKEAAEQLILDAKNVEKAGAVALVLEAIPNDLAEEISKHLTIPVIGIGAGKGTDGQVLVYHDMLNY |
| A0A662QSS7 | 143-223 | None |
| A0A537TCT7 | 378-452 | None |
| A0A396I2Q0 | 74-150 | None |
| A0A445D807 | 2-78 | None |
| A0A812NMZ5 | 61-124 | None |
| A0A840H5X3 | 74-137 | None |
| A0A377CJI8 | 5-85 | None |
| A0A1B0C470 | 426-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.