DPCstruct | MC26121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 221 ± 21 aa |
| Standard deviation of domain lengths | 21.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2K6T3 | 11-234 | RPKDQFKVMQHFDLNTNHLEVLNRLYTPLIGTQAVGLYHFMTQFVKESHNETLILSHYIFMNELKINLLEFRQQMDLLEAIGLLKAF… |
| A0A2K9YTZ1 | 3-210 | ENFFIESEREITQNDFKNLVIFYAPILGHSSIFLYQFLYNLKNIYTKNKLFNFSEIKDILLLNEQEFEECRSKLEALSLLKSYLNKD… |
| S2R6R4 | 8-242 | None |
| A0A2R6XZQ8 | 1-246 | None |
| R5HJJ6 | 3-193 | None |
| A0A6B0Q2N2 | 1-254 | None |
| F9P781 | 1-201 | None |
| A0A415RL65 | 1-224 | None |
| A0A832NGG1 | 1-191 | None |
| A0A2T4RP45 | 1-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.