DPCstruct | MC26118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 319 ± 53 aa |
| Standard deviation of domain lengths | 53.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H6VQN6 | 1-220 | MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVKENSKYDSPMSNWYYWGKVKSLESQFADAIDIIEDYQYGEKEYKDAKDK… |
| A0A2X2JXQ4 | 1-318 | MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSILNRLGDQIYYAKELTNKYEYGEKEYKQAIDK… |
| C4B4R1 | 1-272 | None |
| G5KHP6 | 1-364 | None |
| A0A7Z7VU01 | 1-305 | None |
| A0A3P5Y6A7 | 1-383 | None |
| A0A418JID0 | 7-303 | None |
| A0A5C8XA96 | 11-312 | None |
| A0A2W5ALU4 | 1-416 | None |
| A0A0M5TL83 | 1-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.