DPCstruct | MC26117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 191 ± 27 aa |
| Standard deviation of domain lengths | 27.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.90 |
| Pfam Score | 88.69 |
| Assigned Pfam label(s) | PF06276- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2JY18 | 5-193 | VLLTRYVEGKEDQVEKVLYQLADIDISEIPKDFILLPIHPYQINVLRQHPQYMQYSEQGLIKDLGVSGDSVYPTSSVRTVFSKALNI… |
| A0A4D4LBS3 | 179-395 | PVHLIWLAARRDRSTFTSSADLDYDALIHSELSEETRARFARTLTDLGLNPADYHLLPVHPWQWWNKLSVSFAAEVARQHLVCLGPG… |
| A0A815NXI2 | 178-323 | None |
| A0A0Q0A1P5 | 2-148 | None |
| X0QA35 | 15-220 | None |
| A0A3N4LUL4 | 260-474 | None |
| A0A380FM10 | 1-173 | None |
| A0A843Y7X1 | 1-158 | None |
| A0A828B601 | 116-299 | None |
| D3BU25 | 252-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.