DPCstruct | MC26116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 156 ± 31 aa |
| Standard deviation of domain lengths | 30.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.57 |
| Pfam Score | 77.37 |
| Assigned Pfam label(s) | CL0023- CL0126- CL0063- PF06480- PF13396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2JWE8 | 8-154 | VLVIVIIGVIIFGLFSYLNGNGNMPKQLTYNQFTEKLEKGDLKTLEIQPQQNVYMVSGKTKNDEDYSSTILYNNEKELQKITDAAKK… |
| A0A1S4KLN9 | 133-237 | MMTVALVTTLGILGLLAFNEMRYKEITWKEFVNAYLARGIVEKLEVINKKWVRVRLLPGNQIDGNNVLWFNIGSVDTFERNLENVQL… |
| A0A4S4EIQ9 | 270-387 | None |
| A0A0E0GMT3 | 87-238 | None |
| A0A535L668 | 1-117 | None |
| T1GYF2 | 55-210 | None |
| V5ID67 | 4-175 | None |
| A0A260M2M0 | 7-157 | None |
| A0A146H843 | 545-713 | None |
| A0A6P5FSQ1 | 138-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.