DPCstruct | MC26115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 44.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6DAH9 | 1-99 | AAGRGYRKVVASPLPQTILENQLIGNITDDQNKDIACSGGGIQVKKKENTYEGVEAGIYKDVASEILATLIEADTLMSLTNVENVFI… |
| A0A091C8K1 | 2-85 | PKNIIEIDSVNRLINNNNVVIAGGGGGIPVLKSEGGNIKGVSAVIDKDRSSALLADNIVADKLIILTAVEYVYMNYGKSDQEAL |
| A0A255PAF6 | 127-222 | None |
| A0A6A5KZH3 | 421-510 | None |
| A0A7C3LAY3 | 1-84 | None |
| A0A4U0RVK1 | 24-125 | None |
| D0Z4R1 | 10-104 | None |
| A0A813D975 | 42-142 | None |
| A0A376TJK5 | 101-186 | None |
| A0A841DL44 | 317-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.