DPCstruct | MC2611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 150 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 53.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6LR58 | 93-243 | QPSSATGKESEQQWLWKQALSIDMEDIIYIHLHQRDDSSPSTLTLVNCDGVQCPPLQMTAGQHSLVFLTSLEAGLAPTHRLDPPLWG… |
| A0A7N5KMW6 | 1-160 | MNSEQASCGPNHPSPSSVYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLLSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPP… |
| A0A455BFV3 | 157-294 | None |
| A0A3B4ASC5 | 1-142 | None |
| A0A4W4FK04 | 273-430 | None |
| A0A368FL79 | 1-173 | None |
| A0A6I9PWD4 | 142-287 | None |
| A0A016TIA7 | 330-480 | None |
| A0A480JYP5 | 28-183 | None |
| A0A060YE37 | 413-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.