DPCstruct | MC26109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 207 ± 41 aa |
| Standard deviation of domain lengths | 41.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 58.91 |
| Assigned Pfam label(s) | CL0396- PF17956- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832ZEM2 | 2-140 | VEEVRWELDLRGYDHVRIFLSGGLDEESIKELVDVADAFGVGGSIASAKPVDFSLDIVEVEGKPITKRGKLSGRKQVYRCENGHYHR… |
| A0A2H6AHM5 | 7-207 | DTLRGVRRALEAGVPMKAIRLDSGDLLALSRASRQMLDEANRQDVQIIASGDLNEDRIHDLMVAGAPIDVFGVGTDMVTSRDEPSLN… |
| A0A3N6C7Z6 | 207-379 | None |
| A0A7J6PP42 | 844-1094 | None |
| A0A1F3YCS7 | 226-436 | None |
| A0A2B4SCW9 | 287-493 | None |
| A0A0E0GW51 | 300-544 | None |
| A0A813VLD6 | 242-464 | None |
| A0A7C2D157 | 5-172 | None |
| A0A6J7III4 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.