DPCstruct | MC26103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 195 ± 20 aa |
| Standard deviation of domain lengths | 20.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356TGR1 | 10-191 | TALVHLYRGELQRMVTYRVRLDTTTNWAIGTAAGLISFALGHDGAPHFVLVLGLLMGLVFVWIEARRFQVFEMIRLRVRLLERGFYG… |
| A0A2T1HNW0 | 3-188 | GWRDRIDRTTNWAITVVAAMLSVSLSTPSAHHGVLLFAMLLVWLLLWIEARRYRFFDVYRARVRLMERHYFAEVFDRGATLHATWGR… |
| A0A0B6X0B4 | 42-259 | None |
| A0A4P5QNH4 | 19-230 | None |
| A0A3D1R602 | 11-219 | None |
| A0A849QDN9 | 4-189 | None |
| A0A1M6SJ93 | 2-164 | None |
| A0A7W1SJT9 | 2-154 | None |
| A0A2M7L0F4 | 94-300 | None |
| A0A838BAY8 | 8-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.