DPCstruct | MC2610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 377 ± 54 aa |
| Standard deviation of domain lengths | 54.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.49 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | PF01915- PF20732- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1W9B5 | 2-265 | RFYTNINTLQDVMESVAEFKKELIILDRPNPNGYLIDGPILDMSLKSGIGQFPVPIAHGMTIAEFAQMINGEGWLANKAICPLKIVK… |
| N1UW20 | 9-329 | EEDFSKSPVTVDEFFNLPIYHIYRVKNAELPTILKGADAILFDVQDMGMRCYTYLTVLKRIMDGIPDPTNTRLIVLDHVNPALYLKG… |
| A0A832FRA1 | 1-261 | None |
| A0A0G9L938 | 5-431 | None |
| A0A7V3M396 | 185-559 | None |
| A0A6V8H7G8 | 678-1095 | None |
| A0A2V7KLY1 | 307-599 | None |
| A0A6N8FB81 | 49-496 | None |
| A0A2E9QD90 | 7-435 | None |
| A0A2V5WTP7 | 28-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.