DPCstruct | MC261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 134 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00748 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4HU74 | 1-117 | MSLDALGALCDTLPKDAPKPEPPKVRPQDIVSEGKVKSEKGVRVGEREDTLPPDYRFKEEDLKKLPPPKPEPKMDADDALDILSGDF… |
| A0A3Q3GXY0 | 1-135 | VSLDALNALVDMLPADAPKPELPEVRPEDIVSVGTLAEKGVFVGERDDSIHPDYRFNKAELKKLPAPEPEPTMGTGEALDILLGDFA… |
| H3CAQ4 | 82-226 | None |
| A0A3Q3B996 | 1-142 | None |
| A0A7J5Z2G6 | 9-108 | None |
| A0A3B5AU15 | 1-123 | None |
| A0A3B4VKV7 | 19-146 | None |
| A0A4W4EAE1 | 1-136 | None |
| A0A1S3P5T8 | 694-825 | None |
| A0A672HBN2 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.