DPCstruct | MC26098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 156 ± 13 aa |
| Standard deviation of domain lengths | 12.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9N493 | 1-153 | MSPEHIQQFLQILWDEVNSAEDLHRFIENYGDKLDQDFLAAIAAVVESAARQGNENVARFFNRTGQMLLPLVMPSDAVRIAAAKTQD… |
| K9TJD3 | 1-152 | MTDKRIRAYIKLIQKLLDCPEGDELKILRKHRHLIDVQFVYVLNQAAEKAEEEGEEDTASFLRTLSEQLELAFAEIVKRTHPAVSER… |
| A0A1B1U1U1 | 1-160 | None |
| A0A6M0F5H1 | 1-159 | None |
| A0A6P0WVR2 | 1-170 | None |
| A0A6P0NU52 | 1-127 | None |
| A0A251WL81 | 5-170 | None |
| A0A857D985 | 1-162 | None |
| A0A1C0VUG5 | 11-154 | None |
| A0A4P5ZXQ9 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.