DPCstruct | MC26096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 297 ± 50 aa |
| Standard deviation of domain lengths | 49.90 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8JST1 | 5-200 | TLAWAACLAFSLVTGMPVQAQSAYPPPPAVYTQAQLDQMLAPVALYPDSLLAQVLMAATYPLEVVQAQRFIEARPGLQGDGLARAVA… |
| A0A370FF80 | 25-364 | AALTLALALGACNQTSPSPEAQAPAPAPAPAVQAAPAAAPVPAAYTPPSANELYRLVAPIALYPDKLVAQVLAASTYPDQVTAAHQW… |
| H5Y8H1 | 20-383 | None |
| A0A4R5H109 | 17-308 | None |
| A0A432Z2G0 | 24-361 | None |
| A0A2M7R234 | 23-383 | None |
| A0A1E3WCR2 | 11-285 | None |
| A0A1F4DJK4 | 23-378 | None |
| A0A536ZRG8 | 2-312 | None |
| A0A127QQ37 | 5-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.