DPCstruct | MC26087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K2B6X4 | 1-136 | MAIKPLTHDEIANTEKKLDMPLDDIIKMSKNTAKPKKQQRAPIKNQKMFNNPAHEKALKMRRYMDSRPLVRQAALAQRRSNFQRNQF… |
| A0A835KGV0 | 1-119 | MAIKSLTHEEIANTEKKLDMPLDDIIRMSKNTAKPKKQQRAPIKNQKMFNNPTHEKALKMRHYMDSRPLVRQAALAQRRSNFQRNQF… |
| A0A0K9RMQ9 | 1-118 | None |
| A0A484MS59 | 1-118 | None |
| A0A6P4PGR1 | 1-123 | None |
| A0A2G5DZP0 | 1-122 | None |
| B9GL53 | 1-151 | None |
| A0A6P8BPT8 | 1-134 | None |
| A0A6P5GBZ8 | 1-137 | None |
| A0A4Y7LH25 | 3-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.