DPCstruct | MC26086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438GM52 | 6-98 | MFLTLISLLPFLCYSFSPENPTDRRILVVLDDIGLKSSHSIFFKSLQTRGLELDFKLADDPKISLQRYGQYLYDGLILFSPTTERFG… |
| W9R992 | 3-98 | KLIAFLTLTLILPFLCTSFSPERPTDRRVLVLLDDLALKSSHSFFFKSLQSCGFDLDFKLAENPKIGLQRYGQYLYDALILFSPAVD… |
| A0A455BAD8 | 6-92 | None |
| D3BQ06 | 1-86 | None |
| A0A438JTD3 | 2-98 | None |
| A0A4S4E538 | 4-99 | None |
| A0A4Z2EFP5 | 37-115 | None |
| A0A4S4DJ81 | 4-99 | None |
| A0A3Q7EUP1 | 306-399 | None |
| A0A7J7CQB4 | 3-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.