DPCstruct | MC26085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K1WW44 | 709-792 | KDSRSMKLFKVALADFVKEVLKPSWQQGNMSKEAFKTIVKKTVDKVAGAMKSHQIPKSKVKIDHYIDSSQWKLTKLVMGYVDKY |
| A0A2K2APY8 | 35-117 | ESKVLRHFRSVLIDFVKELLKPTWREGHLSEDAHNTIVKKTAEKVLSSLQPHQIPAAVESIKQFLSSSQPKMTKLVEGYVSKY |
| A0A6P6GBM5 | 708-798 | None |
| A0A654ESE8 | 1-82 | None |
| A0A4Y7KVF1 | 794-881 | None |
| M0ZQH7 | 96-190 | None |
| A0A6A3AT46 | 685-771 | None |
| A0A2K2DJN9 | 872-958 | None |
| A0A835JPU6 | 420-504 | None |
| K4A7M1 | 492-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.