DPCstruct | MC26082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 114 ± 26 aa |
| Standard deviation of domain lengths | 25.79 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1EEL9 | 1-107 | MALLARTDPEEPLLDHLQGVASLAEGFLAPLGLGPEGRVLGLCHDLGKATPYFQEMLRGKRPRGDPLTWHALPGALFAAWVAQKEGL… |
| A0A3R6B1W0 | 3-96 | YIAHISEDKEHIQTVMEHLEGTAELARQFSDAFGFGDWGYCCGKLHDIGKYSQKFQKRIRGSEVRVDHATAGAKACHEKGGFYTALA… |
| A0A7V3AER1 | 95-224 | None |
| A0A543JUZ7 | 222-344 | None |
| A0A0S2W680 | 1-100 | None |
| C0BSK0 | 6-146 | None |
| A0A3E2TJD4 | 2-87 | None |
| C0FMQ8 | 2-128 | None |
| A0A399EZA1 | 106-246 | None |
| X2JUW9 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.