DPCstruct | MC2608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 44.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U0FN27 | 38-183 | VRFDDWRAVYAKFADVPNVALFVEQAEALVTLLAEAAPDAAQQVDLDFGLAITELFTLVVYGQLILEQAEILGLDEGQRSDGVLDQI… |
| N1UC17 | 7-134 | LPNVQIFRKQIAVLKEFLKSTPPDSKQSKDLDFMLILGELFTLVAYGQLLIENAAIEKVDNDLLDQIFDFMVRDCSKYALQLYSKRS… |
| M6GGG6 | 55-196 | None |
| X8EZ84 | 1-144 | None |
| A0A657AFS1 | 51-192 | None |
| A0A655FP68 | 1-144 | None |
| G7H6X8 | 143-285 | None |
| A0A7Y1VHP4 | 1-127 | None |
| A0A1V5FIM6 | 1-135 | None |
| A0A534YN34 | 59-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.