DPCstruct | MC26076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 256 ± 51 aa |
| Standard deviation of domain lengths | 50.71 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A240A4Q5 | 14-230 | VAKRLLDKSKEAFALAVELYNRPTLRYHAEACSIFLCNAWELMLKAHLIAEEGLEAIYYPDNPDRTISLEDCLKRIFSNDKSPLRVN… |
| K1Z3G8 | 2-277 | TRTRKLFSTSKSLVDNSISAILCALEIHNKPNITYRQETVLILLTHAWELLIKWTLYKTWDKNIKKYLQDSLEDKILEEKFGFDDVI… |
| A0A3Q9IIZ4 | 122-324 | None |
| A0A5R9B994 | 8-248 | None |
| A0A7V4XB59 | 73-394 | None |
| A0A2R8BH93 | 75-371 | None |
| A0A7T9FFQ5 | 2-271 | None |
| A0A7W8J9J3 | 3-306 | None |
| A0A2W7AZ61 | 85-327 | None |
| A0A7X1E7W9 | 141-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.