DPCstruct | MC26070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 236 |
|---|---|
| Mean domain length (aa) | 245 ± 42 aa |
| Standard deviation of domain lengths | 41.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 21.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9KSZ7 | 144-372 | NLSGTLEVSSGAELTLRGERLSASLINVNTGGVITHLLTTASAFFKVDLSADTIVVDATGRIGAGARGFLGGLQPGNPFIGGDGMTV… |
| A0A6N7PL81 | 28-298 | ASEAETSPSLTVEPGATATLPGDKVNNLNILTIKSGGVLRVLSPNAPTGTGMLHIRANRIIVESDGMIDGTGSGHPGKMGMPGEGMG… |
| A0A661NNX5 | 143-385 | None |
| A0A7X7KX99 | 111-384 | None |
| A0A7X7KX23 | 3-311 | None |
| A0A7T5RAC0 | 308-619 | None |
| A0A7X7JAC2 | 9-194 | None |
| A0A7X7G5E8 | 200-441 | None |
| A0A2N1V569 | 196-411 | None |
| A0A1I1ZYP0 | 6-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.