DPCstruct | MC2607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 262 ± 50 aa |
| Standard deviation of domain lengths | 50.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5EBK6 | 56-307 | PKLSSPYVRLQILRADFLRKETILTSMQWFHIAMLAGSENAEIDQSHEILVELAPAIVEKVVIPFLIDTVKEEWDPMSLRQTRHLTT… |
| A0A7S3R838 | 47-303 | QAWYTSLFDFGMGAAGEGGTTGMAEDDPDADLVPQLVRKLVLPIAHHLLAKCWEPCSVRQSSAVADIVGDLCVYVPAEEEGMAGVLN… |
| A0A7E5VEA5 | 175-428 | None |
| A0A4W5RWK6 | 2-297 | None |
| A0A4P9WJL6 | 8-266 | None |
| A0A1Y2C7B0 | 122-338 | None |
| A0A0B1S353 | 22-262 | None |
| A0A835PVF2 | 12-289 | None |
| A0A4W3I6H1 | 9-231 | None |
| A0A2P8ZFL6 | 695-946 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.