DPCstruct | MC26069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 177 ± 25 aa |
| Standard deviation of domain lengths | 24.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351ZE30 | 118-293 | GELVVNSNNAHGIASDDDVIIEDGTYYITSVKSGIFAHNDITINGGDLTIFGGTNGIKSKGTLNINGGTALVSGGTKEEKSSVYAAG… |
| A0A1C6EZS1 | 92-274 | DGTFTIDFCDDSLHTNGNLSICGGTYTLSTGDDGMHADGADQVYGGEITIKTCYEGIEGQNMESSGGTIDITASDNGNGALDYNGTA… |
| A0A1Y1V547 | 302-483 | None |
| A0A3R6QB80 | 65-218 | None |
| A0A5P8E4N6 | 789-995 | None |
| A0A7X0SR91 | 138-345 | None |
| A0A3C1DF46 | 16-157 | None |
| A0A1M2Z7H7 | 3-166 | None |
| A0A7X3DK82 | 3-196 | None |
| A0A3R9ZXG7 | 3-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.