DPCstruct | MC26067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 186 ± 25 aa |
| Standard deviation of domain lengths | 24.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07884 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4BBU2 | 8-154 | VWPHFANMALGFWLITSAFALGLRDPRLQASDVVSGVLVLVLAALSLSRRPFWHLWAPWANSLVGVWLLFAPLVFWAPTAAGYANDT… |
| A0A6N1DQ25 | 1-187 | MDEHAQHRHDQHHSVLWAQWLVIGLGAWLVSSPAILGYGFGPVVDPEVARVTAERGLPDPELRNRLMAWSDFASGLLIMIFGALALS… |
| H6RNZ2 | 26-255 | None |
| A0A7S8FEG0 | 363-536 | None |
| Q5P1W1 | 2-196 | None |
| A0A512BZX8 | 75-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.