DPCstruct | MC26066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0191 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6DJY3 | 1-88 | MNAWRHYREGAVKVRLQGLSPERFFNLCGQGEVEIWKISCAGAEYEFYMTVRGFFSCRPFVRKSGVRLKILEKTGLPFFYTETGKEGC |
| D4LGK1 | 3-85 | PGFVRVSVKGQQCQRFVNLCRGREMDLKRIIRTGETELQLTMKVADFLQISPLRRKTGVHIHILKKRGPLFFLLFCKRRKMIP |
| D4KQX0 | 4-93 | None |
| A0A413L471 | 1-84 | None |
| B0MDP6 | 1-89 | None |
| T0CN40 | 1-94 | None |
| A0A3R6QTC9 | 2-117 | None |
| A0A1C6KD27 | 4-106 | None |
| A0A3E2T6J2 | 6-93 | None |
| A0A017RTZ5 | 3-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.