DPCstruct | MC26061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 255 |
|---|---|
| Mean domain length (aa) | 158 ± 21 aa |
| Standard deviation of domain lengths | 21.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.68 |
| Pfam Score | 75.92 |
| Assigned Pfam label(s) | PF11901- CL0235- CL0345- PF12150 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V3IDY4 | 5-144 | KWVTYSGGPQPANLVEAGYRGNGSKTYVARGEIGGELAIGKFQNGTSYIPWNGKENNVSPCELLVCDKPDELLWIPASNGEVPNGAI… |
| A0A182M6C9 | 2-125 | VRAGVDCKGEVIYVGRASHNGDLLPAKVIPDKRTAYVCYGGKEIRKQEIEVLCFITFEWEYGSNGSVPDSALQIGQTAHGEPLYMGR… |
| A0A090L9Q2 | 47-217 | None |
| A0A368G4G9 | 159-293 | None |
| A0A811L7J9 | 43-215 | None |
| A0A0N4ZQN4 | 181-358 | None |
| A0A0N4Z521 | 4-143 | None |
| A0A1Q9EN61 | 2-146 | None |
| A0A257CLX4 | 8-184 | None |
| A0A6L5CEJ7 | 75-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.