DPCstruct | MC2606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JE06 | 4-85 | GDVVWKRGLLRKGYGICHGVAGNAYTFLSLYKLSKDKKHLHRACQFALWCCDYGRHGCRTPDRPYSLFEGMAGTAYFLYDIL |
| A0A7S3R0X1 | 12-96 | RAGEVVWARGILRKGPGLCHGVAGNGFALHKLWKSGAGAKWLHRSQQFGLALGDEEVQQTFHNPDYPYSLFQGCAAGLSFLVDVL |
| A0A7R9D6L9 | 147-229 | None |
| A0A1W0X9P5 | 1072-1163 | None |
| A0A5P1F687 | 266-359 | None |
| T1GVZ8 | 12-84 | None |
| A0A7J7H9V1 | 611-708 | None |
| A0A834F9N1 | 362-455 | None |
| A0A3P7MQJ4 | 2-77 | None |
| A0A443SNN3 | 318-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.