DPCstruct | MC26058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 174 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428SX95 | 709-838 | ALPPTANSKMEEHYKKMYSDEMQVRNIVEVLDRYKHSKDALDQDVFACMIHGLFDEYSHYVDYPLEALATTAVLFGGIISHKLISGL… |
| A0A2V3IC88 | 4-168 | PTTPGSSGTLTAFPASIEKETDDFFQKLYQGELLPDQAVDILRRMKASNVEQDIPVFNCILHTIFDEYRFFKDYPDLQLKITGVVSI… |
| A0A0F7S8C7 | 536-714 | None |
| A0A812U083 | 88-273 | None |
| A0A1B7NZN4 | 88-269 | None |
| G0R1C2 | 456-612 | None |
| A0A0S7JDX3 | 104-288 | None |
| A0A0R3Q869 | 24-220 | None |
| A0A2D4J0V7 | 14-167 | None |
| A0A4Z1IT97 | 609-788 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.