DPCstruct | MC26057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 3.80 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 56.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0Z929 | 1-72 | MSSGTKVGYQYKGEIRTGYVKFMGNSRKGEAKFEFVGTNANGEVTTYHVKQGKDLWKLLNNNKHDKTISTMD |
| A0A0V8JNY8 | 1-78 | MEGARFVIENGIKVKYNYRGEIRTGYIQNIGSSRKGFAKFEFVGTNNNGQITTYHTQSGKKFWKTINGKNVPVINPAE |
| A0A7Y0A0H8 | 83-158 | None |
| A0A1B9JZX5 | 58-136 | None |
| A0A116NAA0 | 248-325 | None |
| A0A7Y1F6W2 | 33-110 | None |
| A0A378MDL3 | 89-171 | None |
| A0A074LYM1 | 377-453 | None |
| A0A4P7WP06 | 176-253 | None |
| A0A0J6P2T1 | 138-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.