DPCstruct | MC26056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 47 ± 8 aa |
| Standard deviation of domain lengths | 8.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G6YQS1 | 49-82 | TPATAGTYVCPMHPEVTSEKPGDCPKCGMALVKQ |
| A0A0G0RQK8 | 1-36 | MKDSSTVKIYTCPMHPEVRSDKPGSCPKCGMSLVAK |
| A0A380CJY4 | 31-71 | None |
| A0A7C3J0Z8 | 79-119 | None |
| A0A849ZF67 | 79-129 | None |
| A0A2G2F409 | 153-203 | None |
| A0A0G1GJ03 | 1-64 | None |
| A0A2X2JE86 | 23-75 | None |
| A0A258ENM6 | 13-58 | None |
| A0A0Q0WQL7 | 28-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.