DPCstruct | MC26052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H3AVN0 | 1-89 | MRRIEIILGELERLTRGLNLAHLAQETAFTAEAIGFNLGLARNSVSKDLNQLWNDGLAIKSRGRPVFFLHRQAIETLLGRKLDESER… |
| A0A242GXW0 | 1-74 | MHRLEKVGNILAEQTKKQKTVEQLKGVTDQEISEVLSLVRNTVSEDLNKLLTNQEAIRVKSRPVLFFSRQELEK |
| A0A6X9J5M3 | 1-89 | None |
| A0A0H3GJQ0 | 1-91 | None |
| A0A150KD37 | 3-78 | None |
| E2SJR8 | 4-89 | None |
| A0A7W1XB39 | 1-63 | None |
| A0A316N478 | 63-147 | None |
| K6Q5Z0 | 1-76 | None |
| A0A1I4IYR6 | 45-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.