DPCstruct | MC26051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1BU17 | 114-172 | VDEIEHSISFHDLIWETPTKSSQAWFVRHFGPEVNLGNIPPDEVIALETLRLGLRADTL |
| A0A847XVJ3 | 1-67 | IINAISENVKLENVIWEAPLKSQQVWFIKHFGHNVNLGNISPDEVIPLESLRLGLRGDTFFQFLPKK |
| A0A7W0T4R5 | 1-52 | None |
| W0BCP3 | 78-137 | None |
| A0A7X7B878 | 2-67 | None |
| T0YAI2 | 107-169 | None |
| A0A533WZN1 | 99-156 | None |
| A0A838F5N8 | 68-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.