DPCstruct | MC26050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5G473 | 29-111 | LSAAAHLIHGSSEGRFTIRYCPGPKVSRDEIESVGYQWGDLDGALHHYDPQKLSTGWNTLGDGEKIFFVPNPALGLWAERSRF |
| A0A847XUX2 | 1-75 | HLIHGSSEGRFSVTYCPGHLSREQIESVRFRYHDIRDAIKKYNPDKMKDGFNEMPDGEKVFYISNPSLGLWSSRE |
| A0A397CEI8 | 53-138 | None |
| A0A7X9E572 | 9-82 | None |
| A0A812VK18 | 300-378 | None |
| A0A4D9D4V5 | 19-108 | None |
| A0A7S3Y5X4 | 138-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.