DPCstruct | MC26049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 218 ± 47 aa |
| Standard deviation of domain lengths | 46.58 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0ZAL9 | 18-215 | SPGLVIRPNTLNIVFNRSESLEYGQYVQHLESFLQQYNDSEQAKNDLCMAGQYSEQDEEPQKKVCQFRRSLLHHCSGMEDTTFGYAK… |
| A0A7R9BTT6 | 7-187 | GVSYVDCSNRDEPLRKNELCEIDISQFGSNCSKAQKFGYSMGKPCIFIKLNKIYGWVPPVFETVDELPEDMPGYLRDEIKSQYSDGQ… |
| A0A1J1IAZ5 | 484-726 | None |
| A0A1I8F8W6 | 108-400 | None |
| A0A5K4FAC5 | 55-280 | None |
| A0A226EQU9 | 34-350 | None |
| A0A226EP79 | 501-816 | None |
| A0A7R8X409 | 48-324 | None |
| A0A1I8IHQ5 | 2-144 | None |
| A0A7R9NW71 | 38-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.