DPCstruct | MC26041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 188 ± 21 aa |
| Standard deviation of domain lengths | 21.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344- PF18069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1E9Z2 | 19-206 | SIGQITITPQSNGGYELRHAEDLGREDLHLHTSADDARGLSFFDDANVYRPLKTAPTLRHGWRLLAGTAGELRAALDHFYPSMTALW… |
| A0A2T6DWA0 | 115-297 | ARARAALVPLLLESGASTVLSAPASASTPAPVLLREWLRWDAAGAFRPLRGAPNLRPGWILGPLSAMQVVEALRLIYPGAVADWALH… |
| A0A838N1C6 | 1-165 | None |
| A0A0R2RDF4 | 9-176 | None |
| A0A2E7PQC9 | 16-193 | None |
| A0A2R6G9C5 | 331-573 | None |
| A0A838W3X6 | 35-213 | None |
| A0A2M8PQU0 | 279-435 | None |
| A0A1H3GYD2 | 165-348 | None |
| E7QXE2 | 298-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.