DPCstruct | MC2604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9BEG4 | 166-282 | LLQYGTRCARCKLENVKVLNDGINWNSGDNLYWKHDMQRFEALKVILHGNAEFEARDVVIQGNYTFDVPDGHKLEITPGVSGLDIQL… |
| F8KVK8 | 650-753 | GKCRLKNVKIRNKGIDFSQKNMFWKQDIHHLESMQIKIHGNGEFIAENVTFEGNIQIEVPHGHQMRAYQKDNQIVYETTQIKKPSWY… |
| A0A7R9Y8H7 | 1-131 | None |
| C1E5I4 | 303-424 | None |
| A0A1D6FS76 | 165-278 | None |
| A0A835EWU2 | 752-871 | None |
| A0A7S2AJI6 | 48-176 | None |
| A0A4D9C5A4 | 297-410 | None |
| A0A835V8U8 | 113-228 | None |
| A0A2K1YWC0 | 437-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.