DPCstruct | MC26034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 62.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3KWN1 | 51-121 | FQTTWSVNNGIDVSELLKDFPDELRADIAMHLNKELLQLPLFESASRGCLRSLSLIIKTSFCAPGEYLIRQ |
| A0A182UA21 | 144-218 | EEYFQHAWTYTNGIDMNSVLKGFPECLQADICLHLNRNLLNNCSAFEAASPGCLRALSLKFKTTHAPPGDILVHK |
| A0A3B3VHC2 | 403-477 | None |
| A0A182XZB9 | 287-361 | None |
| A0A3Q3VY31 | 538-609 | None |
| A0A7R9B2W8 | 4-62 | None |
| A0A820HZ89 | 1-76 | None |
| A0A4W4GM83 | 520-592 | None |
| A0A091CI28 | 354-428 | None |
| A0A060VQV2 | 149-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.