DPCstruct | MC26032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 380 ± 46 aa |
| Standard deviation of domain lengths | 45.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.81 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0020- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3T2W2 | 3-391 | DDEFTCDLFRFLQLLCEGHNNDFQNYLRTQTGSTTTINIIICTVDYLLRLQESISDFYWYYSGKDIIDEPGKRNFSKAMTVAKQVFN… |
| A0A812EJL0 | 2-410 | MKEEEALMIDMNEAEPEVSIKIESEETEPDQFISEQPDNSLEYKNDGYIELVLKVMARMCDGQNQQLQNYLREQPDNVKSFDIIAEV… |
| A0A1I8I4N5 | 2-304 | None |
| A0A1X7TCH8 | 383-786 | None |
| A0A1X7TE24 | 4-373 | None |
| A0A1X7TLS1 | 11-390 | None |
| A0A7J6PI07 | 2-371 | None |
| A0A820UJE2 | 449-775 | None |
| A0A2R7WGW6 | 204-564 | None |
| A0A2I0TIT1 | 24-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.