DPCstruct | MC26031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.87 |
| Pfam Score | 97.87 |
| Assigned Pfam label(s) | CL0028- PF01172- CL0437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5UMD7 | 1-104 | MISLDDAVTAQLESHGERFEVLVDPDAALAIKRGTFDEEFEGQDLEDVIAAEDVFEDAASGDRPPESALEEVFGTTDPMEIIPQVIE… |
| A0A812EIB6 | 5-102 | TPTNQKRLTNVAVVRLKKGGKRFEIACYPNKVMSWRNKVEKDIDEVLQTHTVFMNVSKGQVAKAEDLKRAFGTEDQNQICLQILAKG… |
| A0A1S8VU34 | 7-99 | None |
| A0A5J4YQ86 | 3-98 | None |
| A0A177WH67 | 2-104 | None |
| A0A3M7M081 | 6-107 | None |
| A0A0P7GYP0 | 6-105 | None |
| A0A1A8ZQH0 | 2-97 | None |
| A0A370TMN1 | 96-200 | None |
| A0A061QXC4 | 3-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.