DPCstruct | MC2603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Standard deviation of domain lengths | 14.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3QV57 | 1-114 | MDSDSFGVSRAPRCVQNPQGKDSALTGLLSHTDNKGGPGMTVYVGGCVLDLGAMLGADCGVVIGEDEAFERVAACYGVQVRQLVTAP… |
| A0A5D2PJB5 | 277-406 | HANELSFQESVSTGEIIMEVQSPIDKIEAFNKIIQGCSDDKRNLTVYIGDSVGDLLCLLKADIGIVIGSSSSLRTVGDHYGVSFVPL… |
| A0A3M6UP90 | 218-343 | None |
| A0A6P5RK48 | 242-350 | None |
| A0A2B4R7M6 | 129-246 | None |
| A0A7S0MWK2 | 31-161 | None |
| A0A5N6L0J6 | 569-672 | None |
| M4BDQ1 | 113-208 | None |
| A0A7I4AGE7 | 365-480 | None |
| A0A484MVV1 | 43-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.