DPCstruct | MC26027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 208 ± 29 aa |
| Standard deviation of domain lengths | 28.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8MPM8 | 69-244 | AVALRDVLEPVDAVLGESVTEARVVTGTARAPGSLFVSCPLIVLGDLEVDGVLSDCGPDSTVVVVGRCVAKGLRTSGNFLVLGDLVV… |
| C8NCM4 | 62-295 | RAAAEHIPPKILISAQEAIARYGDRPGSQIADHYDDDSAPVLIYHGDLTLNGDLNSAWLQQQAAELHAAAYRNHIIIDGNLTLQGAL… |
| A0A553DRC5 | 164-400 | None |
| A0A848LQJ5 | 332-526 | None |
| A0A848FVV7 | 165-377 | None |
| A0A1I1RWW6 | 10-297 | None |
| A0A0B5RU45 | 7-218 | None |
| A0A173MPW9 | 188-415 | None |
| A0A6G3ZZ39 | 21-249 | None |
| A0A7S9CC55 | 6-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.