DPCstruct | MC26026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 132 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378GMV1 | 2-139 | MIRTVNPLLLSAGAALLALFLIYTGVSAAEKVTWLMEVTPVIIVVPLLLFTAKRYPLTPLLYTLIFFHAIILMVGGQYTYAKVPIGF… |
| E8KID7 | 1-113 | MITAIAIWSGIAPSERAVWYAEVMPIFVVFGLLVLTYPKFQFSGLAYILMSLWMITHLIGAKYTFANVPFEWANQFLTPILGEDRNH… |
| A0A525WJ75 | 6-137 | None |
| A0A4P5QRA1 | 230-375 | None |
| A0A0Q0F2Y0 | 1-124 | None |
| A0A522A7K3 | 91-231 | None |
| A0A812IMI6 | 552-694 | None |
| A0A2V6F1D9 | 7-128 | None |
| A0A6A7KPT8 | 78-208 | None |
| A0A3B0Y921 | 11-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.