DPCstruct | MC26023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 156 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.35 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF19306- PF08494 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1B7L4 | 116-260 | AATAIHRYVLEQKLFSEIPTDKKLVVEKFDDGRKNYYVFHTLVGRKANSAISRVFAYRAGLKKDCNVQIALNDNGFMLILPLNRVLR… |
| A0A836Q7Z1 | 1-159 | AQGIYESEEMKLVEPLLRLQETWSKIPDEKSVLVEHMHSREGYHLFIYPFEGRLVHEGLAALLAYRMSRLMPATFSLSINDYGFEMV… |
| A0A5C5TWD5 | 43-204 | None |
| A0A377DRV0 | 109-260 | None |
| A0A0P8AYW5 | 350-505 | None |
| A0A1E3GYJ3 | 37-222 | None |
| A0A7C2YY98 | 164-326 | None |
| A0A7W8UU60 | 373-516 | None |
| A0A3D3XMQ8 | 134-301 | None |
| A0A7W1H0P3 | 86-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.