DPCstruct | MC2602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 12.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532V820 | 7-103 | EIVKQVVESKPRTAVKPREFFIAWSGVSTLAYQGFTRPLLGIKRELEQKIPGIKPENPGSKWPKTTLGALRDDRQLSWVDLNILRDI… |
| A0A7S3QKY1 | 1-127 | MGKEDIQQYIKAAHPSFLRPLQFFPAWQGVLTLAFSGFPPSFKKLKEEINENLAAAIPKESPGSMWPKMTLGALKDHVRLTPEMLGR… |
| C1EHG5 | 214-349 | None |
| A0A812TXB5 | 5-98 | None |
| C1MNI7 | 13-125 | None |
| A0A7S2ME15 | 3-105 | None |
| A0A7S4PTE7 | 44-148 | None |
| A0A813BDG0 | 2-98 | None |
| A0A7S0SYQ5 | 80-179 | None |
| A0A2P6V7A0 | 16-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.