DPCstruct | MC26002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 131 ± 22 aa |
| Standard deviation of domain lengths | 21.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6AQW3 | 130-235 | GEDVKLDEKALKQAEELERVAAKAEKIDFATLGVASASDRDDLQIIKGIGPFIEEKLNALGIYTFEQISKMTAKIEEEVNIAIEFFP… |
| A0A847WZ14 | 3-118 | ATVEQSASVQPLAPPSFSPSRRLAGAGIPEPPAITSASSRRPPQLAAPKEAPDDLKKIKGIGKKTESALHDLGIYHFAQIAAWERAH… |
| A0A7Y2GPL4 | 116-258 | None |
| A0A0S8B4P8 | 11-137 | None |
| A0A3D4DQ65 | 146-250 | None |
| A0A7M3ZNY0 | 57-162 | None |
| A0A657LWR3 | 63-193 | None |
| A0A259TV91 | 111-258 | None |
| A0A525VZC0 | 173-301 | None |
| A0A7R7YDQ5 | 69-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.