DPCstruct | MC26001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 190 ± 25 aa |
| Standard deviation of domain lengths | 24.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6PZE9 | 1-179 | MLTTASSTTFNPLSLLHTLSPIPTNLPHCSVFTPPFRYNGARLLGFVPHAISSQEQGVFDSELHSVLQLATGSELYEVERILFGTSY… |
| A0A2N9JBM9 | 29-213 | ASATATVALHFSLPSPITTKLTYHPGFGSPGPGRRIRNGLRLVGCASYANAAISRNGQGAFDPELRTVLELATDSELYELQRILFGP… |
| A0A833XNU1 | 6-180 | None |
| A0A453KYK8 | 18-260 | None |
| A0A5D2K525 | 1-187 | None |
| E1Z6T9 | 1-146 | None |
| A0A822YNB4 | 1-186 | None |
| A0A067DXV5 | 2-183 | None |
| A0A6P6XCW5 | 11-222 | None |
| A0A2P2KJM8 | 1-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.