DPCstruct | MC2600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 162 ± 24 aa |
| Standard deviation of domain lengths | 23.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0XM02 | 355-481 | TTTPTPTASPSATPTPTPVCIDAAWVSGEHGGFEVHARDSYADVLCYGTLPCATEGHVVSRGGRLMTMAELCAHMHGSCYRKTMWVN… |
| A0A2V3IQ05 | 129-253 | GPTAPNASPAAQTSDVCIAARSLAHLSQRDLVYARHRVARVLCDSSGSCATPGHIVLFHGVPMMMTSYCEAVSCVAKIMHVNSPRYT… |
| R7Q934 | 635-847 | None |
| R7Q6G8 | 5-157 | None |
| R7QQZ1 | 269-425 | None |
| A0A7S1XH12 | 208-358 | None |
| A0A5J4YKR1 | 304-474 | None |
| A0A5J4Z403 | 207-373 | None |
| R7QS06 | 452-610 | None |
| A0A2V3J1H7 | 387-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.