DPCstruct | MC260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 63.00 |
| Pfam Score | 86.54 |
| Assigned Pfam label(s) | PF04419- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3GJM4 | 2-82 | ARGHQKFQSQQKNAKKQADIKKSKGHDQKAAAMAALVYTCSVCRTQMPDLKTFKQHFESKHPKSPMPPELGQHVYVCSSTS |
| A0A3L7IPW2 | 431-508 | DHMARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVNS |
| A0A6I9IZF0 | 1-74 | None |
| A0A3S1B263 | 56-148 | None |
| A0A3L8T0M0 | 177-250 | None |
| A0A663N4I2 | 33-106 | None |
| F6USR9 | 144-220 | None |
| A0A672H530 | 1-61 | None |
| A0A7R8D597 | 20-98 | None |
| A0A0N4V253 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.